Protein Info for DZA65_RS09695 in Dickeya dianthicola ME23

Annotation: GTP cyclohydrolase I FolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 TIGR00063: GTP cyclohydrolase I" amino acids 51 to 231 (181 residues), 280.9 bits, see alignment E=1.8e-88 PF01227: GTP_cyclohydroI" amino acids 51 to 229 (179 residues), 205.8 bits, see alignment E=1.9e-65

Best Hits

Swiss-Prot: 92% identical to GCH1_PECCP: GTP cyclohydrolase 1 (folE) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 98% identity to ddd:Dda3937_03497)

MetaCyc: 89% identical to GTP cyclohydrolase 1 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase I. [EC: 3.5.4.16]

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CUP7 at UniProt or InterPro

Protein Sequence (234 amino acids)

>DZA65_RS09695 GTP cyclohydrolase I FolE (Dickeya dianthicola ME23)
MSAVLTKSAVLTRSAILTKEATQVHEALLARGLETPLRGKMLESETRKRLIAEHMTEIMN
LLNLDLADDSLAETPHRIAKMYVEEIFSGLDYANFPKITIIENKMKVDEMVTVRDITLTS
TCEHHFVTIDGKATVAYIPKEGVIGLSKINRIVQFFSQRPQVQERLTQQILVALQTLLGT
NNVAVSIDAVHYCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHQN