Protein Info for DZA65_RS09525 in Dickeya dianthicola ME23

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 281 to 288 (8 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details PF12911: OppC_N" amino acids 11 to 44 (34 residues), 24.3 bits, see alignment 2.3e-09 PF00528: BPD_transp_1" amino acids 158 to 338 (181 residues), 95.3 bits, see alignment E=3.8e-31

Best Hits

Swiss-Prot: 78% identical to YEJE_ECOLI: Inner membrane ABC transporter permease protein YejE (yejE) from Escherichia coli (strain K12)

KEGG orthology group: K13895, microcin C transport system permease protein (inferred from 96% identity to ddd:Dda3937_03826)

MetaCyc: 78% identical to putative oligopeptide ABC transporter membrane subunit YejE (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C399 at UniProt or InterPro

Protein Sequence (341 amino acids)

>DZA65_RS09525 ABC transporter permease subunit (Dickeya dianthicola ME23)
MSRLSPINQARWARFRANRRGYWSLWIFLVLFVVTLCAELVANDKPLLVRYDGQWYVPFM
VDYSETAFGGQLATPADYRDPWLVQRLEQGGWALWPLIHYRYDTINYATQSAFPSSPSRQ
NLLGTDSQGRDVLAQVLYGFRISILFGLTLTLLSSLIGIAVGASQGYYGGRVDLWGQRLI
EVWSGMPTLFLIILLSSVIQPNFWWLLGITVLFGWMTLVGVVRAEFLRTRNFDYIRAAQA
MGVSDRAIMFRCMLPNAMVATLTYLPFILCGSITTLTSLDFLGFGLPMGSASLGSLLLEG
KNNLQAPWLGITVFMVLAVVLSLLIFIGEAVRDAFDPGKAH