Protein Info for DZA65_RS09500 in Dickeya dianthicola ME23

Annotation: 16S rRNA pseudouridine(516) synthase RsuA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF01479: S4" amino acids 1 to 47 (47 residues), 38.5 bits, see alignment 7.5e-14 PF00849: PseudoU_synth_2" amino acids 62 to 192 (131 residues), 78.8 bits, see alignment E=5.4e-26 TIGR00093: pseudouridine synthase" amino acids 66 to 223 (158 residues), 192 bits, see alignment E=3e-61

Best Hits

Swiss-Prot: 77% identical to RSUA_SALTI: Ribosomal small subunit pseudouridine synthase A (rsuA) from Salmonella typhi

KEGG orthology group: K06183, ribosomal small subunit pseudouridine synthase A [EC: 5.4.99.12] (inferred from 95% identity to ddd:Dda3937_03822)

MetaCyc: 77% identical to 16S rRNA pseudouridine516 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11833 [EC: 5.4.99.19]

Predicted SEED Role

"Ribosomal small subunit pseudouridine synthase A (EC 4.2.1.70)" (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12 or 5.4.99.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWC9 at UniProt or InterPro

Protein Sequence (232 amino acids)

>DZA65_RS09500 16S rRNA pseudouridine(516) synthase RsuA (Dickeya dianthicola ME23)
MRLDKFLSQQLGISRSLIVRELRAQRVTVNGEVVKSGAFKLLPDHEVTFDDNVLEQQNGP
RYFMLNKPQGYVCSTDDPDHPTILYFIDEPVANKLHAAGRLDIDTSGLVLLTDDGQWSHR
ITSPKHHCEKTYLVTLEQPLAPDTADNFQAGVQLHGEKDLTRPATLEPVSEYQVRLTISE
GRYHQVKRMFAAVGNHVVALHRERIGAITLDDALEPGEYRPLTPEEVAGIGQ