Protein Info for DZA65_RS09280 in Dickeya dianthicola ME23

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 269 to 294 (26 residues), see Phobius details amino acids 314 to 344 (31 residues), see Phobius details amino acids 357 to 375 (19 residues), see Phobius details PF12704: MacB_PCD" amino acids 23 to 236 (214 residues), 79.2 bits, see alignment E=5.3e-26 PF02687: FtsX" amino acids 273 to 386 (114 residues), 64.8 bits, see alignment E=7.5e-22

Best Hits

KEGG orthology group: None (inferred from 94% identity to dze:Dd1591_2472)

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYP3 at UniProt or InterPro

Protein Sequence (393 amino acids)

>DZA65_RS09280 ABC transporter permease (Dickeya dianthicola ME23)
MNVTQQWLEACRNLIAFHQRASLAMLGIGVGSALVVALLMLGKSAQQMALSAFDNLGGDI
IVVDIGIKEDSHSPVPLLPVKLDLSVLSRVHHGIRRVVPVARWNTSLPQKGDENGIPLMV
IGSTPDLMPLLGLTLTQGRAFSRYDSRSTYAIVSADLASRLSGSASARTFLLGHYAFDVI
GALKSATLSIGGQTTGHVVLVPIETITRISPFATTDLLYIQVTSTALVTPVVNAIRPWLE
QMLPTRTIQIQIQQQIIDSMAQQNATFRYLLAALAAVALLMGGIGVMNVMVMSVSMRRHE
IGLRQAIGARSLDIGVLFLLEAALLSLPGAVLGSVAGALLAWAYTRYADWPLMADPWVFP
LAIGSALVLAVFFGLKPSLTAARLSPAEALREH