Protein Info for DZA65_RS09215 in Dickeya dianthicola ME23

Annotation: outer membrane protein OmpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF06316: Ail_Lom" amino acids 5 to 170 (166 residues), 74.8 bits, see alignment E=8.2e-25 PF13505: OMP_b-brl" amino acids 9 to 170 (162 residues), 91.5 bits, see alignment E=7.8e-30

Best Hits

Swiss-Prot: 66% identical to OMPX_ENTCL: Outer membrane protein X (ompX) from Enterobacter cloacae

KEGG orthology group: K11934, outer membrane protein X (inferred from 95% identity to dze:Dd1591_2485)

Predicted SEED Role

"Attachment invasion locus protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CG27 at UniProt or InterPro

Protein Sequence (170 amino acids)

>DZA65_RS09215 outer membrane protein OmpX (Dickeya dianthicola ME23)
MKKIACLSALACVLAVSAGTAVAGESTVSLGYAQGDAQSVQNKLPGFNLKYRYEFDNQFG
VVGSFTYLQDSQTDSGVYNKAQYYGFSAGPSFRFNDWASIYGLVGVSAAKFTANNTDGSS
NNSTSDAGFVYGAGLQFNPVQNVAFDVGYEQSRVRSVDVGSWNVGVGYRF