Protein Info for DZA65_RS09210 in Dickeya dianthicola ME23

Annotation: threonine/homoserine exporter RhtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details PF00892: EamA" amino acids 148 to 280 (133 residues), 64.1 bits, see alignment E=8.2e-22

Best Hits

Swiss-Prot: 65% identical to RHTA_ECO57: Threonine/homoserine exporter RhtA (rhtA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_02882)

MetaCyc: 65% identical to L-threonine/L-homoserine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN0-0244

Predicted SEED Role

"Putative DMT superfamily metabolite efflux protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C463 at UniProt or InterPro

Protein Sequence (293 amino acids)

>DZA65_RS09210 threonine/homoserine exporter RhtA (Dickeya dianthicola ME23)
MTLISALKNSVLLPVLLIIIAMLSIQTGAAMAKMVFPLIGASGMTALRLAIGALILLAVF
KPWRLRVGSDRLPLLVYGITLGGMNYLFYLALRTVPLGVVVALEFTGPLAVAILASRRLL
DFMWVLLAAAGLWLLLPLGQHIDNVDLTGAAFAVGAGACWAGYILFGQKAGANHGAGTVA
MGSLIAALVYCPIGLLFSDINSLFSLSILPIGIAVAVLSTALPYTLEMLALTRLPTRTFS
TLMSLEPAVAAMSGILFLGERLSLTQWLALAFIILASLGTTLSVKKHAASASS