Protein Info for DZA65_RS09030 in Dickeya dianthicola ME23

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 286 to 314 (29 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 397 to 417 (21 residues), see Phobius details amino acids 450 to 469 (20 residues), see Phobius details amino acids 499 to 521 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 261 (169 residues), 38.5 bits, see alignment E=5.4e-14 amino acids 349 to 527 (179 residues), 80 bits, see alignment E=9.4e-27

Best Hits

Swiss-Prot: 84% identical to FBPB_SERMA: Fe(3+)-transport system permease protein SfuB (fbpB) from Serratia marcescens

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 97% identity to ddd:Dda3937_03767)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D8U9 at UniProt or InterPro

Protein Sequence (530 amino acids)

>DZA65_RS09030 iron ABC transporter permease (Dickeya dianthicola ME23)
MADVEWKVAGVGVTQPVRPGARPYRIAGGGMALMALLLSLLALLPLGFVVGITLETDWET
IKALVFRPRVGELLLNTVLLVVVTLPLCTLLGVALAWLTERTTLPGRRVWSLLLTAPLAV
PAFVQSYAWISLLPGMHGLAAGVFLSVLAYFPFIYLPAAAVLRRLDPSLEDVATSLGARP
WRVFFRVVLPQLRLAVWGGSLLIALHLLAEYGLYAMIRFDTFTTAIFEQFQSTFNGLAAN
MLAGVLVLCCLGLLLLEALTRGRARYARVGSGSARSQSPRRLSSSAALVCVLLPLALTVL
ALGVPLMTLARWLWLGGLEVWRNDELWPALRQTLWLGVGGAALVTLCAFPMAWLSVRHPS
RLYRLLEGCNYITSALPGIVVALALVTVTIHTLRPLYQTEFTLLLAYVLMFMPRALINLR
AGIAQAPVELENVARSLGCSPGRALWRITLRLAAPGAAAGAAMVFLAVTNELTATLLLAP
NGTRTLATGFWALTSEIDYMAAAPYALIMVMLSLPLTWLLYSQSKRTAGL