Protein Info for DZA65_RS08990 in Dickeya dianthicola ME23

Annotation: excinuclease ABC subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 TIGR00631: excinuclease ABC subunit B" amino acids 5 to 663 (659 residues), 1099.5 bits, see alignment E=0 PF04851: ResIII" amino acids 12 to 87 (76 residues), 39.3 bits, see alignment E=1.9e-13 PF17757: UvrB_inter" amino acids 159 to 249 (91 residues), 111.1 bits, see alignment E=6.6e-36 PF00271: Helicase_C" amino acids 436 to 545 (110 residues), 71.5 bits, see alignment E=2.1e-23 PF12344: UvrB" amino acids 552 to 593 (42 residues), 77.4 bits, see alignment 1.8e-25 PF02151: UVR" amino acids 630 to 665 (36 residues), 35.2 bits, see alignment 2.2e-12

Best Hits

Swiss-Prot: 90% identical to UVRB_PECAS: UvrABC system protein B (uvrB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 98% identity to ddd:Dda3937_03753)

MetaCyc: 88% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C6G1 at UniProt or InterPro

Protein Sequence (670 amino acids)

>DZA65_RS08990 excinuclease ABC subunit B (Dickeya dianthicola ME23)
MNKAFKLHSDFKPAGDQPEAIRRLEDGLEDGLAHQTLLGVTGSGKTFTVANVIADLNRPT
MVLAPNKTLAAQLYGEMKAFFPENAVEYFVSYYDYYQPEAYVPSSDTFIEKDASVNEHIE
QMRLSATKALLERRDVVVVASVSAIYGLGDPDLYLKMMLHLTQGMLIDQRAILRRLAELQ
YARNDQAFARGTFRVRGEIIDIFPAESEDIALRVELFDEEVERLSLFDPLTGHIVQTVPR
YTIYPKTHYVTPRERILQAMEEIKVELADRRQVLLAGNKLLEEQRLAQRTTFDLEMMNEL
GYCSGIENYSRFLSGRGPGEPPPTLFDYLPADGLLVIDESHVTIPQLGGMYRGDRARKET
LVEYGFRLPSALDNRPMKFEEFEALAPQTIYVSATPGNYELEKSGGEVIDQVVRPTGLLD
PQLEVRPVTTQVDDLLSEIRKRAVINERVLVTTLTKRMAEDLTEYLEEHGERVRYLHSDI
DTVERVEIIRDLRLGEFDVLVGINLLREGLDMPEVSLVAILDADKEGFLRSERSLIQTIG
RAARNLNGKAILYADRITPSMERAMNETQRRREKQQAYNEQHGIVPQGLNKKIGDLLQIG
QSANGRGKGRGKKAAEPAAQYQQLSPKALDQKIRELESQMLTHAQNLEFEEAARLRDEIH
ALREQFIAAS