Protein Info for DZA65_RS08945 in Dickeya dianthicola ME23

Annotation: CidB/LrgB family autolysis modulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 47 (19 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 89 to 113 (25 residues), see Phobius details amino acids 133 to 164 (32 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details TIGR00659: TIGR00659 family protein" amino acids 1 to 226 (226 residues), 318.5 bits, see alignment E=1.1e-99 PF04172: LrgB" amino acids 11 to 223 (213 residues), 266.7 bits, see alignment E=6.8e-84

Best Hits

Swiss-Prot: 75% identical to YOHK_ECOLI: Inner membrane protein YohK (yohK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_03743)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XZM5 at UniProt or InterPro

Protein Sequence (231 amino acids)

>DZA65_RS08945 CidB/LrgB family autolysis modulator (Dickeya dianthicola ME23)
MNYLWWSLPLTLAVFFGARKVAMTLKMPLLNPLLVSMLVIIPLLLALDIPYTHYFSGSAI
LNSLLQPAVVALAFPLYEQLHQIRARWKSIISVCFIGSVTAIISGTVIALWLGASREIAA
SVLPKSVTTPIAMAVASSIGGIPAISAMCVILVGIVGAVLGHALFNRLKIHAKSARGLAM
GTASHALGTARCAEVDFQEGAFSSLALVICGIITSLIAPFLFPVIVRLMGS