Protein Info for DZA65_RS08930 in Dickeya dianthicola ME23

Annotation: molybdopterin molybdotransferase MoeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF03453: MoeA_N" amino acids 7 to 167 (161 residues), 172.8 bits, see alignment E=6.8e-55 TIGR00177: molybdenum cofactor synthesis domain" amino acids 177 to 313 (137 residues), 114.8 bits, see alignment E=1.6e-37 PF00994: MoCF_biosynth" amino acids 181 to 316 (136 residues), 113.6 bits, see alignment E=9.5e-37 PF03454: MoeA_C" amino acids 331 to 403 (73 residues), 73 bits, see alignment E=2.9e-24

Best Hits

Swiss-Prot: 71% identical to MOEA_ECOLI: Molybdopterin molybdenumtransferase (moeA) from Escherichia coli (strain K12)

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 94% identity to ddd:Dda3937_03740)

MetaCyc: 71% identical to molybdopterin molybdotransferase (Escherichia coli K-12 substr. MG1655)
RXN-8348 [EC: 2.10.1.1]

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.10.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CPN0 at UniProt or InterPro

Protein Sequence (411 amino acids)

>DZA65_RS08930 molybdopterin molybdotransferase MoeA (Dickeya dianthicola ME23)
MDTSDLLSLEQALQTMLAQVSPLNATETISIYQAAGRITATAVTSPLDVPPFDNSAMDGY
AVRCHELNGQPLPVAGKAFAGAPFDASWPTSSCIRIMTGAPIPAGADAVVMQEDTESDAD
GRVHFTRAVKPGQNIRRTGEDIRRQAQVLPAGTRLGTAELPLLASLGISAVEVVRRLRVA
LFSTGDELQPVGEPLQPGQIYDTNRFTVRLMLEQLGYEVIDLGIVRDDPAALRQAFQEAD
QVADVVISSGGVSVGEADYTKQMLETLGDIRFWKLAIKPGKPFAFGKLSHAWFCGLPGNP
VSAAVTFYQLVQPLLARLSGHTGWSLPARFRVKTATPLKKSLGRLDFQRGILTRTAEGDL
EVRTTGHQGSHVFSSFSQGNCFIVLEAERGRVEAGEWVDVEPFNPLLQGHC