Protein Info for DZA65_RS08825 in Dickeya dianthicola ME23

Annotation: Hcp family type VI secretion system effector

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 TIGR03344: type VI secretion system effector, Hcp1 family" amino acids 1 to 168 (168 residues), 214.5 bits, see alignment E=4.4e-68 PF05638: T6SS_HCP" amino acids 7 to 155 (149 residues), 111.4 bits, see alignment E=2e-36

Best Hits

Swiss-Prot: 59% identical to MAJE_PSEAE: Major exported protein (hcpA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11903, type VI secretion system secreted protein Hcp (inferred from 97% identity to ddc:Dd586_1272)

Predicted SEED Role

"Hcp"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CDJ3 at UniProt or InterPro

Protein Sequence (172 amino acids)

>DZA65_RS08825 Hcp family type VI secretion system effector (Dickeya dianthicola ME23)
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVQGHEDEMLVQEFNHVVTVPTDPQSGQPA
GQRIHKPFKFTVALNKAVPLLYNALASGEMLPTVTLKWYRTSVEGKQEHFFTTTLTDATI
VDINNQMPHCQDPSKQDYTQLIEVSLAYRKVDWEHTVAGTSGSDDWRAPIEA