Protein Info for DZA65_RS08735 in Dickeya dianthicola ME23

Annotation: helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF12833: HTH_18" amino acids 35 to 111 (77 residues), 82 bits, see alignment E=3.2e-27 PF00165: HTH_AraC" amino acids 73 to 111 (39 residues), 40.5 bits, see alignment 2.2e-14

Best Hits

KEGG orthology group: K05804, right origin-binding protein (inferred from 89% identity to ddd:Dda3937_00754)

Predicted SEED Role

"Right origin-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C8S0 at UniProt or InterPro

Protein Sequence (299 amino acids)

>DZA65_RS08735 helix-turn-helix domain-containing protein (Dickeya dianthicola ME23)
MMLSTMPSMMRFTADLIGWIENHLESPLMINDVTAKSGYSKWHLQRIFKKETGVSLGSYI
RSRRLSKAAIELKLTNQTIQDVALRYCFDSQQSFTRTFKKHFGMSPGHYRKALRWDFSGL
QPSLGDSVDWLPIPEVVDLPARPVNTSFFEHTQNIDDFISASDIPQRIKLWEQTSRQYSG
PDVVIYSFSTFIPDPNRINRHVRVAYHISAVDPYDNVDADNVSGQTSAETERYLRFMFAG
DVAEYTSFLKTIYHHILPGQAYTRMSGGDLEVIRCKKGAQGRIDTDYFEAEYYIPFDRQ