Protein Info for DZA65_RS08730 in Dickeya dianthicola ME23

Annotation: DHA2 family efflux MFS transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 53 to 73 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 360 to 386 (27 residues), see Phobius details amino acids 402 to 421 (20 residues), see Phobius details amino acids 476 to 494 (19 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 15 to 494 (480 residues), 477.7 bits, see alignment E=2e-147 PF07690: MFS_1" amino acids 20 to 412 (393 residues), 169.5 bits, see alignment E=9.7e-54 PF00083: Sugar_tr" amino acids 41 to 185 (145 residues), 39.6 bits, see alignment E=3.2e-14

Best Hits

Swiss-Prot: 45% identical to FARB_NEIGO: Fatty acid resistance protein FarB (farB) from Neisseria gonorrhoeae

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 95% identity to ddd:Dda3937_00755)

MetaCyc: 47% identical to multidrug efflux pump membrane subunit EmrB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C6F3 at UniProt or InterPro

Protein Sequence (508 amino acids)

>DZA65_RS08730 DHA2 family efflux MFS transporter permease subunit (Dickeya dianthicola ME23)
MNDKAAFTPPNPGLATLAISLATFMQVLDSTIANVSLPTIAGNLGVSSDQSTWVITSFAV
CNAISLPLTGWLARIVGQRRLFVVSVLLFSLASFLCGFSRSMTELIVFRALQGFFAGPMY
PMCQTLLLMIFPPSRRNMALALLAMVTVVGPIVGPITGGWVTDNYTWPWIFYINVPIGLF
AAGVVMAQLRDWQDTTMRARVDYVGIGLLVLGVGLLQVVLDKGNDLDWFASADIVTMSVI
SAIALVSFVIWELGERDPLVNLRLFADRNFTIGTVSLMLGYAAFFAINVILPQWLQTWMG
YTSTWAGLAAAPMGMLPLLLTPIVGRYGNRVDLRLLASLSFVIMGLSCLMRAQFTIDVDF
ITVAGVQLFMGIGVAFFFVPLTSILLSNLHGKDVAEGSGLSTFLRVLGGGFASSLTTWIW
SHREIYHHAVLSESVSVYNPAAVDYLNQMGGINQTTLAQLDKTVQQQAWMASTVDYFHLL
GWGFMALVVIIWFARPPFTKAGPAAAGH