Protein Info for DZA65_RS08725 in Dickeya dianthicola ME23

Annotation: HlyD family efflux transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 34 to 36 (3 residues), see Phobius details PF25917: BSH_RND" amino acids 56 to 242 (187 residues), 43.5 bits, see alignment E=6.1e-15 PF25919: BSH_CusB" amino acids 61 to 241 (181 residues), 35.6 bits, see alignment E=1.7e-12 PF25881: HH_YBHG" amino acids 89 to 182 (94 residues), 31.4 bits, see alignment E=4.9e-11 PF25885: HH_EMRA" amino acids 91 to 210 (120 residues), 117.1 bits, see alignment E=1.5e-37

Best Hits

Swiss-Prot: 46% identical to EMRK_ECOLI: Probable multidrug resistance protein EmrK (emrK) from Escherichia coli (strain K12)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 92% identity to ddd:Dda3937_00756)

MetaCyc: 46% identical to tripartite efflux pump membrane fusion protein EmrK (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-365

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CK82 at UniProt or InterPro

Protein Sequence (392 amino acids)

>DZA65_RS08725 HlyD family efflux transporter periplasmic adaptor subunit (Dickeya dianthicola ME23)
METTTHSSEPRASRRKGYFAILLLVLLLGAAGSTAYYQLYLRFYETTDNAYVGGNLITLT
PQVGGTVTQVSVDDGDYVEKGQLLVQLSQSDTLIALQQSEAQLASAVRQVRGLYSTVDNY
QAQVASRQVALQQAIGDYNRRKGLATKGAISAEDLAHYQDAVNSARSALDAAEQALRTNQ
ARVDNTVLDDHPDIKNAVADLRSKYLDWARSAVVAPVSGYVARRAVQVGMRVSAGATLMT
IVPLDQVWVDANFKESQMLQMRLGQPVTLTADIYGDKNVYHGTIQSLGIGTGSAFSLLPA
QNASGNWIKIVQRLPVRIALEPEGLKQRPLRIGLSMLANVDLHNTQGELLPAAPVNAPRY
RTDVYDDPLRQADNLVAKILRDNSQPLTSSRG