Protein Info for DZA65_RS08690 in Dickeya dianthicola ME23

Annotation: methyltransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF01209: Ubie_methyltran" amino acids 12 to 153 (142 residues), 52.2 bits, see alignment E=2.2e-17 PF13489: Methyltransf_23" amino acids 37 to 151 (115 residues), 42.6 bits, see alignment E=2.1e-14 PF05175: MTS" amino acids 43 to 123 (81 residues), 28.9 bits, see alignment E=3.2e-10 PF13847: Methyltransf_31" amino acids 51 to 156 (106 residues), 69.2 bits, see alignment E=1.4e-22 PF13649: Methyltransf_25" amino acids 56 to 148 (93 residues), 80.4 bits, see alignment E=5.2e-26 PF09445: Methyltransf_15" amino acids 56 to 110 (55 residues), 27.5 bits, see alignment E=8.5e-10 PF08242: Methyltransf_12" amino acids 57 to 150 (94 residues), 51.8 bits, see alignment E=4.6e-17 PF08241: Methyltransf_11" amino acids 57 to 151 (95 residues), 86 bits, see alignment E=9.3e-28

Best Hits

KEGG orthology group: None (inferred from 91% identity to ddd:Dda3937_00763)

Predicted SEED Role

"SmtA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0V5 at UniProt or InterPro

Protein Sequence (255 amino acids)

>DZA65_RS08690 methyltransferase domain-containing protein (Dickeya dianthicola ME23)
MDDITQDGLLNEVKHYWNNRAEGYNEVNVAELAGGKRRLWQEIILRHAPKKSLLNILDVG
AGPGFFAITLAMAGHRVTAVDATPAMLAQAKNNADVYGVDIAFVAADVHTLPFPDNHFDV
LVTRNVTWNLKQPLAAYQEWRRVLAPGGRLINFDANWYAHLFNAEARDGYLRDRQNARRL
KMNDHYANTDTVAMENIARALPLSREIRPAWDRHTLLGCGFNQIFIDENIADNLWDDEEK
INYASTPMFMVVAEK