Protein Info for DZA65_RS08680 in Dickeya dianthicola ME23

Annotation: CidA/LrgA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details PF03788: LrgA" amino acids 23 to 111 (89 residues), 100.6 bits, see alignment E=1.9e-33

Best Hits

Swiss-Prot: 70% identical to YOHJ_SALAR: UPF0299 membrane protein YohJ (yohJ) from Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

KEGG orthology group: K06518, holin-like protein (inferred from 94% identity to ddd:Dda3937_00772)

Predicted SEED Role

"Antiholin-like protein LrgA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CZ55 at UniProt or InterPro

Protein Sequence (138 amino acids)

>DZA65_RS08680 CidA/LrgA family protein (Dickeya dianthicola ME23)
MRTFITHFWHQARAFLLLYACLYLGIGVSAVLPITLPGSIIGMLILFLLLSLQIIPAQWV
KPGCHVLIRYMALLFVPIGVGVMQYFDLLRAQFAPVIISCAVSTLVVLITVSGCSHLIHG
RKPAHHQADAEKGADHAA