Protein Info for DZA65_RS08580 in Dickeya dianthicola ME23

Annotation: DotU family type IV/VI secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 219 to 240 (22 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 38 to 247 (210 residues), 237.8 bits, see alignment E=5.3e-75 PF09850: DotU" amino acids 39 to 240 (202 residues), 232.7 bits, see alignment E=1.7e-73

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 96% identity to dze:Dd1591_2799)

Predicted SEED Role

"Outer membrane protein ImpK/VasF, OmpA/MotB domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CW72 at UniProt or InterPro

Protein Sequence (258 amino acids)

>DZA65_RS08580 DotU family type IV/VI secretion system protein (Dickeya dianthicola ME23)
MSTDIIKSDQLGDLLYDNARQLDMDSDYWFRLRGHSINPMIDAVTPLLGMVERVRQLSEY
DGVAELYQRVQSEIQAIEQELHAHGYENGVILSFRYILCTFIDEAVMGREWGGQSVWSAH
SLLTRFHNETWGGEKVFVLLEKLLDDPARYRDILEFIYLCLCLGFEGRYRVMTQGREELD
RVVRRLHDTLRPEPENSPTVFHLNLGQPSSRYHLRKQISLRTLLVGLCVVMAAAFGLYRY
QLTNQTQDVLRQLGELLQ