Protein Info for DZA65_RS08565 in Dickeya dianthicola ME23

Annotation: type VI secretion system-associated FHA domain protein TagH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 TIGR03354: type VI secretion system FHA domain protein" amino acids 7 to 403 (397 residues), 389.6 bits, see alignment E=1.6e-120 PF20232: T6SS_FHA_C" amino acids 228 to 400 (173 residues), 146.6 bits, see alignment E=3.5e-47

Best Hits

KEGG orthology group: K11894, type VI secretion system protein ImpI (inferred from 96% identity to ddd:Dda3937_00812)

Predicted SEED Role

"Uncharacterized protein ImpI/VasC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DC13 at UniProt or InterPro

Protein Sequence (409 amino acids)

>DZA65_RS08565 type VI secretion system-associated FHA domain protein TagH (Dickeya dianthicola ME23)
MNENNPLTLVVLNSEQLDINSQVQHRFDHRGGTLGASEKDQWQLRDRLGAVLPEHAGIEL
QDGHFCVCDLSGQTFINGALSPIGRDRRVCLEHGDELVIGPFRLGVYLEDPAREQDIDQV
LGQRPGDVLEGWLDEERHRPTVEETTAGRFNDPLWALQQEQSRSPLATEGERGDELPASL
SSFSAVEDTMDQKFVELPTIDNPHINKPHAGAGLDGQVDAVTLAPLLRGLGVSLNTGDEQ
QRREMLEEVGRSLKAMVEGLLTLQADQAALADTHLRPIEDNPLRLGLDYTDTLSLLFADD
KSPVHLSAPAAISEVLSNMQAHHRANQQAIAVALESILQAFSPAALLGRFEHYRRSGERQ
ALDDGWAWQMYQHYYRELTSPRQQGFQKLFHQVYAQAYDRAVRQQQEQK