Protein Info for DZA65_RS08550 in Dickeya dianthicola ME23

Annotation: type VI secretion system baseplate subunit TssE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 TIGR03357: type VI secretion system lysozyme-like protein" amino acids 13 to 142 (130 residues), 132 bits, see alignment E=5.2e-43 PF04965: GPW_gp25" amino acids 34 to 122 (89 residues), 71.2 bits, see alignment E=2.7e-24

Best Hits

KEGG orthology group: K11905, type VI secretion system protein (inferred from 98% identity to ddd:Dda3937_00815)

Predicted SEED Role

"Uncharacterized protein similar to VCA0109"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CTQ0 at UniProt or InterPro

Protein Sequence (143 amino acids)

>DZA65_RS08550 type VI secretion system baseplate subunit TssE (Dickeya dianthicola ME23)
MPSLSAWERGSAASLFDRIRGEERRSSPETELEDLIASVKRQLDQVLNTRPGSCRSAPEL
GVIDFNDATQGGADIRGKIREAIRQCICRFEPRIVHVDVSASDYLSNPLEMSFQVTAHVR
LDDLEQVASFNIHMDSHRHYRMM