Protein Info for DZA65_RS08530 in Dickeya dianthicola ME23

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 21 to 50 (30 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 253 to 284 (32 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 435 to 458 (24 residues), see Phobius details PF01554: MatE" amino acids 39 to 199 (161 residues), 78.8 bits, see alignment E=1.9e-26 amino acids 272 to 422 (151 residues), 70.3 bits, see alignment E=8.3e-24 TIGR00797: MATE efflux family protein" amino acids 39 to 427 (389 residues), 170.5 bits, see alignment E=2.7e-54

Best Hits

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_01227)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XW68 at UniProt or InterPro

Protein Sequence (469 amino acids)

>DZA65_RS08530 MATE family efflux transporter (Dickeya dianthicola ME23)
MMTKLLPNANRSREPTAKQLTTDILVGPILPVMLRLALPTIAVLVVQALVGVVETYFVSS
LGADVLAGVAVVFPVLMLMQMMANGGIGGGLSSAISRASGAGRWQDAQALVWHGVIIAGV
LGAAFAAIILIGGEALYHVMGVKGPSLSAALAYSNLVFAGAPLVWLVALLSAALRGAGDT
KTPARITLLGGVILLPLSPVLILGWGPIPSFGVAGAGIAILLYYLFATLLLVRHMRSANS
VIRLSIAPLSSRLFKDVLGVGFLSAIGTVQINLTVTVVTAVVGLFGPDAIAGYGIASRLD
YLQIPLLFGLGTAIMTMVGVNIGAGQKQRAQRIAWVGAAVAFTFTELIGLGAAVYPRLWL
SLFSDDHVILAAGTRYLQNVAPFYGAIGIGMALYFAGQGAKRVLWPVLAGTVRMAIAAFV
GWLAVTQYGADLPSLFQIVALSALIYGVITVAASFVIGRSKPLAISART