Protein Info for DZA65_RS08445 in Dickeya dianthicola ME23

Annotation: malonate decarboxylase holo-ACP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 TIGR03135: malonate decarboxylase holo-[acyl-carrier-protein] synthase" amino acids 5 to 198 (194 residues), 143 bits, see alignment E=5.5e-46 PF20866: MdcG_N" amino acids 5 to 76 (72 residues), 59.7 bits, see alignment E=2.4e-20 PF10620: MdcG" amino acids 94 to 200 (107 residues), 112.6 bits, see alignment E=1.1e-36

Best Hits

Swiss-Prot: 68% identical to MDCG_KLEPN: Phosphoribosyl-dephospho-CoA transferase (mdcG) from Klebsiella pneumoniae

KEGG orthology group: K13934, phosphoribosyl-dephospho-CoA transferase [EC: 2.7.7.66] (inferred from 90% identity to dze:Dd1591_2606)

MetaCyc: 68% identical to phosphoribosyl-dephospho-CoA transferase (Klebsiella pneumoniae)
Malonate decarboxylase holo-[acyl-carrier-protein] synthase. [EC: 2.7.7.66]

Predicted SEED Role

"Phosphoribosyl-dephospho-CoA transferase (EC 2.7.7.-)" in subsystem Malonate decarboxylase (EC 2.7.7.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.- or 2.7.7.66

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVS2 at UniProt or InterPro

Protein Sequence (205 amino acids)

>DZA65_RS08445 malonate decarboxylase holo-ACP synthase (Dickeya dianthicola ME23)
MATTRPHDLLWLTSRDALEEIDARWVHSQWRPALPVVVRRDVDPAGRVPVGVRGLRRDQR
AAGWVAAAHIVRVVTPEMLRELPSLLDSPFVSQPPVQVAIQLAQQRWPWQWGITGGTGYA
LATQVPVLHADSDLDLLIRAPQALDRDALADWQRQLSSSRLCRADTQVETPNGGFALAEW
LRDGQALLKTDRGPRRVSDPWSMEW