Protein Info for DZA65_RS08230 in Dickeya dianthicola ME23

Annotation: zinc-binding alcohol dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF03435: Sacchrp_dh_NADP" amino acids 135 to 226 (92 residues), 28.7 bits, see alignment E=1.5e-10 PF00107: ADH_zinc_N" amino acids 145 to 263 (119 residues), 42.6 bits, see alignment E=5.9e-15

Best Hits

KEGG orthology group: None (inferred from 82% identity to pao:Pat9b_3933)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XW04 at UniProt or InterPro

Protein Sequence (311 amino acids)

>DZA65_RS08230 zinc-binding alcohol dehydrogenase family protein (Dickeya dianthicola ME23)
MKAAIVTEKGKLPVYGDFPEPQADDKHVVVSVKASAVSQLAKSRAAGTHYSASLQYPFIA
GIDGTGYLSNGDPVYFLAFTSPWGSMAQRTQAPVAGIVPLPATVDLVQAAALANPGMSSW
TALTRRAQLRKDETVLINGATGTSGGLAVRIARHLGAGKVIVTGRNHEMLEKLRAEGADV
AITLDALPTKLPALMAEGIDVVLDYLWGQSALDIMTAAIAGGEKVVRFVQIGSLSGQDIA
LHSKLLRSSGLTLMGSGLGSVSNSELVASVGELLDAAARSDFSIPFQRRPLSEVNHAWVE
DDSRCRTVFTL