Protein Info for DZA65_RS08175 in Dickeya dianthicola ME23

Annotation: formate dehydrogenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 259 to 278 (20 residues), see Phobius details TIGR01582: formate dehydrogenase, beta subunit" amino acids 7 to 287 (281 residues), 474.5 bits, see alignment E=4.6e-147 PF12800: Fer4_4" amino acids 38 to 51 (14 residues), 14.3 bits, see alignment (E = 2.6e-05) amino acids 131 to 145 (15 residues), 14.7 bits, see alignment (E = 1.8e-05) PF12838: Fer4_7" amino acids 38 to 114 (77 residues), 31.8 bits, see alignment E=8.7e-11 PF13247: Fer4_11" amino acids 92 to 188 (97 residues), 90.7 bits, see alignment E=3.4e-29 PF13237: Fer4_10" amino acids 94 to 144 (51 residues), 34.4 bits, see alignment 9.7e-12 PF00037: Fer4" amino acids 130 to 147 (18 residues), 22.7 bits, see alignment (E = 3.7e-08) PF09163: Form-deh_trans" amino acids 246 to 286 (41 residues), 65.3 bits, see alignment 1.8e-21

Best Hits

Swiss-Prot: 82% identical to FDNH_ECOLI: Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit (fdnH) from Escherichia coli (strain K12)

KEGG orthology group: K08349, formate dehydrogenase-N, beta subunit [EC: 1.2.1.2] (inferred from 97% identity to dze:Dd1591_2661)

MetaCyc: 82% identical to formate dehydrogenase N subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase O beta subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DP66 at UniProt or InterPro

Protein Sequence (302 amino acids)

>DZA65_RS08175 formate dehydrogenase subunit beta (Dickeya dianthicola ME23)
MSMQSQDIIQRSATSSLTPPPQVRDDKSEVAKLIDVTTCIGCKACQAACSEWNDIRDEVG
HNAGVYDNPADLSAKSWTVMRFSEVESADRLEWLIRKDGCMHCAEPGCLKACPSAGAIIQ
YANGIVDFQSEHCIGCGYCIAGCPFNIPRLNKQDNRVYKCTLCVDRVSTGQEPACVKTCP
TGAIRFGTKEEMKQLAAERVAHLQKRGYDNAGLYDPEGVGGTHVMYVLHHADKPSLYHNL
PDNPKISTPVNLWKGILKPLSTLGFVATFAGLMFHYIGIGPNTEETAHPHEGQPQEGADK
HE