Protein Info for DZA65_RS08120 in Dickeya dianthicola ME23

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 48 (48 residues), see Phobius details transmembrane" amino acids 71 to 90 (20 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 199 to 224 (26 residues), see Phobius details amino acids 246 to 272 (27 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details PF01032: FecCD" amino acids 25 to 335 (311 residues), 302.3 bits, see alignment E=1.7e-94

Best Hits

Swiss-Prot: 95% identical to CBRB_DICD3: Achromobactin transport system permease protein CbrB (cbrB) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 95% identity to ddd:Dda3937_02847)

Predicted SEED Role

"Siderophore achromobactin ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CRK8 at UniProt or InterPro

Protein Sequence (340 amino acids)

>DZA65_RS08120 iron ABC transporter permease (Dickeya dianthicola ME23)
MSHAMIPAGTRMAPGPVLAGGGVCLLALAFLSLMVGPIAIAPSQVLGALWHPDPLNVSHI
LVTSTRLSRTLIAIVVGGSLAVAGALMQVLTRNPLASPGLFGINAGAMFLLIVCVSLFPN
VAMTVWLWSAFAGAAAAGCLVWLIGTMGKGSLNPLRMVLAGAAITAMFAAFSQAMLVVNQ
EGLDTVLFWLAGSVADRELAAALPLMGYCLAALAGALLLSGQVNVLNAGEAIARGLGQRT
GRIRLLMSLLVVALAGGAVAMAGSIGFVGLIVPHMARKLLPADHRWLLPGCALLGACLLL
LADILARVVIVPQEVPVGVMTALFGAPFFLFLLRRGGRYG