Protein Info for DZA65_RS08065 in Dickeya dianthicola ME23

Annotation: CRISPR-associated endonuclease Cas3''

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 753 PF18019: Cas3_HD" amino acids 23 to 150 (128 residues), 31 bits, see alignment E=5.2e-11 TIGR01596: CRISPR-associated endonuclease Cas3-HD" amino acids 25 to 189 (165 residues), 88.8 bits, see alignment E=2.2e-29 PF04851: ResIII" amino acids 253 to 394 (142 residues), 31.6 bits, see alignment E=3e-11 PF00270: DEAD" amino acids 256 to 406 (151 residues), 53.2 bits, see alignment E=6.1e-18 PF22590: Cas3-like_C_2" amino acids 465 to 564 (100 residues), 59.8 bits, see alignment E=5.8e-20

Best Hits

KEGG orthology group: K07012, (no description) (inferred from 94% identity to ddd:Dda3937_02857)

Predicted SEED Role

"CRISPR-associated helicase Cas3" in subsystem CRISPRs

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVX4 at UniProt or InterPro

Protein Sequence (753 amino acids)

>DZA65_RS08065 CRISPR-associated endonuclease Cas3'' (Dickeya dianthicola ME23)
MAERLSFIAHVKRNNDGDWSTPHYLDAHLREVAELAAAIAPTALSDWATLAGRWHDLGKY
RPPFQDYLRKASGYDAENAHIEHAPGRVSHSIAGARYAITALGNGVGHILAYAISGHHAG
LPNGRGDAGSLYNRLTTGDDEYQQAREQAIPADILQAIPVSLPPLSEENIALWLRMLFSC
LVDADFLDTERYMSPENAARREKTASLTLASLQPRYQSHMHTLAGRNPQSPLHQLRQSIL
DETRQAAALAPGLFSLTVPTGGGKTLASLGFALDHALRHGKKRIIYAIPYTSIIEQNAAV
FRQALGEEAVIEHHCNLDNSDDARARLACENWDAPVIVTTNVQLFESLHAARPSRCRKLH
NLADSVIILDEAQQLPRDFHAPITQVMQQLTELFGVSWLLCTATQPVLEAQRNPFGQLLM
PGLAQVREIIARPSQLADVLRRVDVRFSLTPCDWQTLAAELAAQPCVLCIVNTRGDARTL
YQRLADDPDVLHLSAQMCAEHRSQVITQIKQRLAARQQGDSRPLRVISTQLVEAGVDLDF
PTVWRAIAGLDAIAQAAGRCNREGKLTRPGIVQVFMPPALPPAGALRQAAQCTLEMVNAG
LLTDPLSPAAFRDYFTRFNSKGERDRHGIGRLLRAEPDSEIGLALCFRDAAEKFRLIDDT
GVAVIVPWQPDDEEPSPVEYWLQCLESDAGAHWVYRKLQRYSVNVPQTLAARLQALGALQ
PRAGLLVLLESHYCRNTGVKLPEALLSAEDSVI