Protein Info for DZA65_RS08045 in Dickeya dianthicola ME23

Annotation: CRISPR-associated protein Cas4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 TIGR00372: CRISPR-associated protein Cas4" amino acids 8 to 186 (179 residues), 132.7 bits, see alignment E=6.4e-43 PF01930: Cas_Cas4" amino acids 10 to 185 (176 residues), 97.2 bits, see alignment E=1.1e-31 PF12705: PDDEXK_1" amino acids 34 to 185 (152 residues), 37.1 bits, see alignment E=3.4e-13

Best Hits

KEGG orthology group: K07464, putative RecB family exonuclease (inferred from 96% identity to ddd:Dda3937_02861)

Predicted SEED Role

"CRISPR-associated RecB family exonuclease Cas4"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D7Q8 at UniProt or InterPro

Protein Sequence (213 amino acids)

>DZA65_RS08045 CRISPR-associated protein Cas4 (Dickeya dianthicola ME23)
MDDARLVPISALQHYAFCPRQCALIHTEQVWADNWLTAQGTMLHQRVDHGLPETRRGIRY
ERGVIVQAPQLGLSGKLDLLEQVLATGALTPVEYKRGKPKIHQADKVQLCAQALALEEMS
GRSIPVGALWYWETRRRLDVELDDALRTHTRQLIAAVSHLLQQGDTPHATPGKHCLACSL
NELCQPSLQHTDRSGDYIRRLYLMEERDEETPE