Protein Info for DZA65_RS08040 in Dickeya dianthicola ME23

Annotation: type I-C CRISPR-associated endonuclease Cas1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR03640: CRISPR-associated endonuclease Cas1, subtype I-C/DVULG" amino acids 3 to 339 (337 residues), 475.5 bits, see alignment E=9.7e-147 TIGR00287: CRISPR-associated endonuclease Cas1" amino acids 7 to 335 (329 residues), 278 bits, see alignment E=9.6e-87 PF01867: Cas_Cas1" amino acids 8 to 295 (288 residues), 334.2 bits, see alignment E=2.9e-104

Best Hits

Swiss-Prot: 49% identical to CAS1A_CHLTE: CRISPR-associated endonuclease Cas1 1 (cas1-1) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_02862)

Predicted SEED Role

"CRISPR-associated protein Cas1" in subsystem CRISPRs

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWH3 at UniProt or InterPro

Protein Sequence (341 amino acids)

>DZA65_RS08040 type I-C CRISPR-associated endonuclease Cas1 (Dickeya dianthicola ME23)
MKKLQNSLYITRDGAWLHKERETLLIEQTVDGQRQKLLQVPIHSVGNIFCFGNVLVSPQL
MGFCGENGTQLSFFDPFGRFLARVVGRQSGNVLLRRAQFQATTTQATTLARHILTAKIQS
SRRVLLRHLRTYGDNPALQAAADRLRQIVAELPAKTDIERLRGLEGEAASHYFGVFDSLI
ATRSELRFNGRSRRPPRDPVNALLSFFYAILSKEISGALQGVGLDPQVGFLHQERPGRDS
LALDLLEEFRAPLVDRLVLTLINRQQVAIQDFTTDLLGGVTLKDEARKRVLQAWQARKQE
EITHPFLNEKVAIGLLPHMQAMLLARHLRGDLAHYPPYVLR