Protein Info for DZA65_RS07975 in Dickeya dianthicola ME23

Annotation: phosphonate C-P lyase system protein PhnK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 205 to 221 (17 residues), see Phobius details TIGR02323: phosphonate C-P lyase system protein PhnK" amino acids 13 to 259 (247 residues), 393.6 bits, see alignment E=1.6e-122 PF00005: ABC_tran" amino acids 31 to 182 (152 residues), 119.1 bits, see alignment E=2.3e-38

Best Hits

Swiss-Prot: 87% identical to PHNK_ECOLI: Putative phosphonates utilization ATP-binding protein PhnK (phnK) from Escherichia coli (strain K12)

KEGG orthology group: K05781, putative phosphonate transport system ATP-binding protein (inferred from 99% identity to ddd:Dda3937_04092)

MetaCyc: 87% identical to ATP-binding cassette protein PhnK (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphonates transport ATP-binding protein PhnK" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVI6 at UniProt or InterPro

Protein Sequence (260 amino acids)

>DZA65_RS07975 phosphonate C-P lyase system protein PhnK (Dickeya dianthicola ME23)
MLAAGTGGDDETPLLQVRNLTHLYAPGKGFSEVSFDLYPGEVLGIVGESGSGKTTLLRAI
SARLTPQAGQIDYQGRSLYAMSESDRRRLLRTEWGVVHQHPLDGLRPRVSAGGNIGERLM
AVGARHYGDIRRQAGQWLQDVEIPLSRLDDLPTTFSGGMQQRLQIARNLVTHPKLVFMDE
PTGGLDVSVQARLLDLLRTLVRDLGLAVVIVTHDLGVARLLAHRLLVMREGRVVESGLTD
RVLDDPHHPYTQLLVSSVLG