Protein Info for DZA65_RS07895 in Dickeya dianthicola ME23

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF00005: ABC_tran" amino acids 32 to 173 (142 residues), 116.7 bits, see alignment E=1.8e-37

Best Hits

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 95% identity to ddd:Dda3937_04124)

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWA0 at UniProt or InterPro

Protein Sequence (285 amino acids)

>DZA65_RS07895 ABC transporter ATP-binding protein (Dickeya dianthicola ME23)
MAMSAHPLHPLLQVNGVDLRYRTHRAQIQATHDVSFDVFPAERFVLLGPSGCGKSSLLKA
IGGFLSPAGGSIRLENQPVTRPGPDRMMVFQEFDQLPPWKTVLENTLFPLVASGTLPPSE
ARERALHFLDKVGLATFADAYPHTLSGGMKQRVAIARALAMQPKILLMDEPFAALDALTR
RKMQEELLALWEEVRFTLLFVTHSIEEALVVGSRVLLLSPHPGRVRAEINCHQFSLDDAG
GDAFQHTARRIHDLLFPPTPAPRGASALHEVSHDYIPPDQARVSA