Protein Info for DZA65_RS07825 in Dickeya dianthicola ME23

Annotation: hydrogenase 4 subunit H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF12837: Fer4_6" amino acids 32 to 55 (24 residues), 30.3 bits, see alignment (E = 1.1e-10) PF12797: Fer4_2" amino acids 32 to 52 (21 residues), 25.4 bits, see alignment (E = 3.9e-09) PF13237: Fer4_10" amino acids 33 to 86 (54 residues), 32.7 bits, see alignment E=2.4e-11 PF00037: Fer4" amino acids 34 to 56 (23 residues), 27.8 bits, see alignment (E = 6.7e-10) amino acids 73 to 90 (18 residues), 32.2 bits, see alignment (E = 2.6e-11) PF14697: Fer4_21" amino acids 36 to 90 (55 residues), 35.1 bits, see alignment E=4.8e-12 PF12838: Fer4_7" amino acids 39 to 89 (51 residues), 51.1 bits, see alignment E=6.1e-17 PF13187: Fer4_9" amino acids 39 to 90 (52 residues), 39.3 bits, see alignment E=2.2e-13

Best Hits

Swiss-Prot: 54% identical to HYCF_ECOLI: Formate hydrogenlyase subunit 6 (hycF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_00734)

MetaCyc: 54% identical to hydrogenase 3 iron-sulfur protein HycF (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"Formate hydrogenlyase complex 3 iron-sulfur protein; Formate hydrogenlyase subunit 6; Ni,Fe-hydrogenase III medium subunit"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0D3 at UniProt or InterPro

Protein Sequence (189 amino acids)

>DZA65_RS07825 hydrogenase 4 subunit H (Dickeya dianthicola ME23)
MIKLFKTILKAGNSTVKYPFAPLAVPAGFRGKPEYDPAQCIGCAACTMACPANALTMAND
LDNGTRTWQLFLGRCIFCGRCEEVCPTRAIVLSQEFEMAVANKADLYQRATFQLLNCHVC
QRPFAPQKEVEYAMALLAHAGVPESEVEARRHQFETCPDCKRKQNMNHQGNVRLSQHLPT
PTTHKGNAQ