Protein Info for DZA65_RS07820 in Dickeya dianthicola ME23

Annotation: NADH-quinone oxidoreductase subunit B family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF01058: Oxidored_q6" amino acids 47 to 155 (109 residues), 95.9 bits, see alignment E=8e-32

Best Hits

Swiss-Prot: 69% identical to HYFI_ECOLI: Hydrogenase-4 component I (hyfI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_00735)

MetaCyc: 68% identical to hydrogenase 3 iron-sulfur protein HycG (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"Formate hydrogenlyase subunit 7" in subsystem Formate hydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D7H9 at UniProt or InterPro

Protein Sequence (263 amino acids)

>DZA65_RS07820 NADH-quinone oxidoreductase subunit B family protein (Dickeya dianthicola ME23)
MSMLPNGVDHYHTTPITLDEQAQQLKKTLLKDIQRSAYVYRVDCGGCNGCEIEIFSAITP
LFDAERFGIKVVASPRHADILLFTGAVTRAMRSPALRAYESAPDPKICISYGACGCGGGI
FHDLYCVWGGSDKIVPIDVYIPGCPPTPAATIYGFAVALGLLEQKLHGSDHQQAEQEQAT
LIHPAVPLDLRVRVEREARLMAGYRQGREISDRFLDLLANQPLDGFEHRVNRWINQYDDP
RLNEIVGHLLQIYQAMLRGEALS