Protein Info for DZA65_RS07520 in Dickeya dianthicola ME23

Annotation: aspartyl/asparaginyl beta-hydroxylase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF05118: Asp_Arg_Hydrox" amino acids 46 to 199 (154 residues), 122 bits, see alignment E=1.1e-39

Best Hits

KEGG orthology group: K00476, aspartate beta-hydroxylase [EC: 1.14.11.16] (inferred from 40% identity to lpf:lpl2383)

MetaCyc: 52% identical to (1S)-1-[(2S)-2-amino-4-methylpentanamido]ethyl(methoxy)phosphinate desaturase (Streptomyces luridus)
1.14.19.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.11.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D0H1 at UniProt or InterPro

Protein Sequence (229 amino acids)

>DZA65_RS07520 aspartyl/asparaginyl beta-hydroxylase domain-containing protein (Dickeya dianthicola ME23)
MKGSISKNNAFLRNLLNKLFLFSVGGSRRPPLLTADEVFPESRILEAHFPQIHQEITSLI
NKRELTRYKDIDPVRAAEVSENWKLYYAWFMWEENERARTDCPTLLRLVKTMPNVINATV
AVLEPRVTLAAHEGPYAGILRYHIGIEVPEKNPPYIRVMNEFHTWQVGKSVVLDDCYEHE
VYNEADDKRVILMIDFMRPMITPLSFINLCCLKMKKKWGGVMINKANND