Protein Info for DZA65_RS07505 in Dickeya dianthicola ME23

Annotation: Trm112 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

Swiss-Prot: 46% identical to Y2896_RHOS5: UPF0434 protein Rsph17025_2896 (Rsph17025_2896) from Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)

KEGG orthology group: K09791, hypothetical protein (inferred from 46% identity to rsq:Rsph17025_2896)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D9R7 at UniProt or InterPro

Protein Sequence (54 amino acids)

>DZA65_RS07505 Trm112 family protein (Dickeya dianthicola ME23)
MFNIEMLASLICPISQLTLNYDPERQCLISADGQYEYPIINGIPVLLPHNAMEE