Protein Info for DZA65_RS07490 in Dickeya dianthicola ME23

Annotation: 2-aminoethylphosphonate--pyruvate transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 133 to 152 (20 residues), see Phobius details TIGR03301: 2-aminoethylphosphonate aminotransferase" amino acids 5 to 357 (353 residues), 363.8 bits, see alignment E=5.9e-113 PF00266: Aminotran_5" amino acids 27 to 285 (259 residues), 54.6 bits, see alignment E=9e-19 PF00155: Aminotran_1_2" amino acids 57 to 354 (298 residues), 31.3 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 39% identical to PHNW_HAHCH: 2-aminoethylphosphonate--pyruvate transaminase (phnW) from Hahella chejuensis (strain KCTC 2396)

KEGG orthology group: K03430, 2-aminoethylphosphonate-pyruvate transaminase [EC: 2.6.1.37] (inferred from 39% identity to hch:HCH_03085)

Predicted SEED Role

"2-aminoethylphosphonate:pyruvate aminotransferase (EC 2.6.1.37)" in subsystem Phosphonate metabolism (EC 2.6.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D0G2 at UniProt or InterPro

Protein Sequence (369 amino acids)

>DZA65_RS07490 2-aminoethylphosphonate--pyruvate transaminase (Dickeya dianthicola ME23)
MKTALFTPGPGNTTDEVRAALNCDIGTRTPQMTELTRHLCQQIAEVAKCGDDFDVVPIQG
SGTFAVEAMLTSLLPAQAPCLVLSNGPYGERMAEICQIHALPHYVLRSDPLRPIDVVEVA
DYLQRHPNIAALALIHFETGIGILNPLAALLALAQQHGIRVLVDSMSAFGLLPIEFASPA
LSAVAASSNKVLHGVPGLGLVIARRDRLMDPRPARTLSLNLQAQYLGFQRDGMWRFTPPV
QVIAALSRAISDYLREGGQNARLQRYQRRASRVIAGLASFGIRPLVPESYGAPVIATFVL
PFDAEVLSASSLSERLLAYQVAIYPSQVSEVNSFRIGFIGELTENDVDRLIAAIGEVVSE
RRGALEQSI