Protein Info for DZA65_RS07470 in Dickeya dianthicola ME23

Annotation: phosphoenolpyruvate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 56% identical to PEPM_TETPY: Phosphoenolpyruvate phosphomutase (PEPM) from Tetrahymena pyriformis

KEGG orthology group: K01841, phosphoenolpyruvate phosphomutase [EC: 5.4.2.9] (inferred from 58% identity to aaa:Acav_2122)

MetaCyc: 56% identical to phosphoenolpyruvate mutase subunit (Tetrahymena pyriformis)
Phosphoenolpyruvate mutase. [EC: 5.4.2.9]

Predicted SEED Role

"Phosphoenolpyruvate phosphomutase (EC 5.4.2.9)" (EC 5.4.2.9)

MetaCyc Pathways

2-aminoethylphosphonate biosynthesis (3/3 steps found)
methylphosphonate biosynthesis (2/4 steps found)
fosfomycin biosynthesis (2/7 steps found)
FR-900098 and FR-33289 antibiotics biosynthesis (1/10 steps found)
dehydrophos biosynthesis (3/13 steps found)
rhizocticin A and B biosynthesis (2/12 steps found)
phosalacine biosynthesis (4/25 steps found)
phosphinothricin tripeptide biosynthesis (4/25 steps found)

KEGG Metabolic Maps

Aminophosphonate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C1L4 at UniProt or InterPro

Protein Sequence (297 amino acids)

>DZA65_RS07470 phosphoenolpyruvate mutase (Dickeya dianthicola ME23)
MSTREKNGKNQRLREMITSPELSFLMESHNALSAKIAERAGFSGLWASGLTISAALGLSD
RNEASWTQVLDVVEFMTDHVDVPILLDGDTGFGNYHNVIRLVKKLCQKHVSGVCIEDKIF
PKMNSFLGERQKLADIDDFCSKIKAAKDTQFDDDFVIVARTEALISSLGMAEALKRAEHY
RQAGADAILIHSKRDSADEVLAFAAEWANRSPLVIVPTKYYSTPTDVFRQAKISTIIWAN
HSLRSSIVAMREITRHIFENQSINLIEQGIATLEDVFALTNEVNANLADLRYKAVRE