Protein Info for DZA65_RS07465 in Dickeya dianthicola ME23

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 301 to 318 (18 residues), see Phobius details amino acids 324 to 347 (24 residues), see Phobius details amino acids 359 to 382 (24 residues), see Phobius details amino acids 388 to 406 (19 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 366 (339 residues), 120.4 bits, see alignment E=4.3e-39 amino acids 301 to 407 (107 residues), 33.7 bits, see alignment E=1e-12

Best Hits

KEGG orthology group: None (inferred from 71% identity to eay:EAM_0411)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D7I8 at UniProt or InterPro

Protein Sequence (417 amino acids)

>DZA65_RS07465 MFS transporter (Dickeya dianthicola ME23)
MKDRATLCSADLTMRQTLATFPRNVSILLFFTLLTRLSYFMAWPFLSIILTRTYQLTPLA
IGSLMSGCALISVILGIYGGSLSDRLGRKTLLVLGCLLAIVGYAGIALANGVFVFAFGLL
LTGISFSWIDAPSRAFMSDLLQDQKRRELALQIRYFAVNIAAVSGPLIGITFGLNSQKST
FLLTAFSYIPFLLFSLWCIPPGKPLHHDSAKESHDEGMPAWQVVRLIFRDNIYIIILISS
ILCYLVYAQIESIVPQYLLMLDTVRAVDVVTAILVTNAVTVLVAQFYLVPLFANTPLEQR
IMIGALIFALSQMLFWANDTTSTLWWGGCAMVFSIAEAILLPNLSILLDRLAPERYRGAY
LGASTLVVLGLSLGPFVGGALLEWSGKGVFVMMALFCLSIAALMLINKKKIKHRLEE