Protein Info for DZA65_RS07405 in Dickeya dianthicola ME23

Annotation: nuclear transport factor 2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF14534: DUF4440" amino acids 24 to 130 (107 residues), 31.9 bits, see alignment E=1.6e-11 PF13474: SnoaL_3" amino acids 36 to 138 (103 residues), 34.8 bits, see alignment E=1.9e-12

Best Hits

KEGG orthology group: None (inferred from 89% identity to eca:ECA1594)

Predicted SEED Role

"Beta-glucosidase (EC 3.2.1.21)" in subsystem Beta-Glucoside Metabolism or Fructooligosaccharides(FOS) and Raffinose Utilization (EC 3.2.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.21

Use Curated BLAST to search for 3.2.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C7N8 at UniProt or InterPro

Protein Sequence (152 amino acids)

>DZA65_RS07405 nuclear transport factor 2 family protein (Dickeya dianthicola ME23)
MSNALPIYEQNYSDEERTLSDHLISLEKSALDKWFKGDTSGYESLWSERSFTYFDAVVTE
RVDDYETIKEFLKSIEGKLFSDSYDFLHPRVQAVKDMAVLTYQLYAKTNRIDMEYNVVEV
FQREDDNWKVIHSTWSFIRPMDKKFPHVDAVI