Protein Info for DZA65_RS07380 in Dickeya dianthicola ME23

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF13404: HTH_AsnC-type" amino acids 18 to 59 (42 residues), 57.3 bits, see alignment E=1.6e-19 PF13412: HTH_24" amino acids 18 to 65 (48 residues), 51.6 bits, see alignment E=8.2e-18 PF01037: AsnC_trans_reg" amino acids 82 to 158 (77 residues), 46.8 bits, see alignment E=3.4e-16

Best Hits

Swiss-Prot: 32% identical to REG6_PYRHO: Uncharacterized HTH-type transcriptional regulator PH1519 (PH1519) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: None (inferred from 71% identity to bpy:Bphyt_2726)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CX23 at UniProt or InterPro

Protein Sequence (166 amino acids)

>DZA65_RS07380 Lrp/AsnC family transcriptional regulator (Dickeya dianthicola ME23)
MDKDVNVVQTKLIQQPKLDAKDRTLLAILAEDASLSYTELGRQLHLSAPAVHERVKRLKS
EGVITGTVARLDSNKIGRPLLAFIHVDTSSWAVTRSILSLKSLADVEEIHTVAGDSAMLL
KVRTQNTQSLEALLEVIHSIDGFTGTRSYIVLTPHLERGPAPLLSN