Protein Info for DZA65_RS07165 in Dickeya dianthicola ME23

Annotation: nucleotide sugar dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 PF03721: UDPG_MGDP_dh_N" amino acids 1 to 169 (169 residues), 111.4 bits, see alignment E=6.1e-36 TIGR03026: nucleotide sugar dehydrogenase" amino acids 1 to 377 (377 residues), 338.6 bits, see alignment E=2.3e-105 PF00984: UDPG_MGDP_dh" amino acids 192 to 281 (90 residues), 96.9 bits, see alignment E=9.4e-32 PF03720: UDPG_MGDP_dh_C" amino acids 301 to 375 (75 residues), 29.7 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 74% identical to UDG8_ECOLX: UDP-glucose 6-dehydrogenase (ugd) from Escherichia coli

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 97% identity to ddd:Dda3937_03269)

MetaCyc: 73% identical to UDP-glucose 6-dehydrogenase (Escherichia coli K-12 substr. MG1655)
UDP-glucose 6-dehydrogenase. [EC: 1.1.1.22]

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVX7 at UniProt or InterPro

Protein Sequence (388 amino acids)

>DZA65_RS07165 nucleotide sugar dehydrogenase (Dickeya dianthicola ME23)
MKIAIAGTGYVGLSNAMLLSQHNEVVAVDIVAEKVEMLNKGISPIVDKEIEAYLRNPALN
FRATLDAVSAYQDAEFVIIATPTDYDPKTNYFNTRSVEAVISKVLEVNPHAVMIIKSTIP
VGYTAQVREQFGTDNIIFSPEFLREGRALYDNLYPSRIVVGERSERAERFARLLVEGAIK
TNIPVLFTGLTEAEAIKLFANTYLAMRVAYFNELDTYAQTLGLDSKQIIEGVGLDPRIGQ
HYNNPSFGYGGYCLPKDTKQLLANYESVPNNLIRAIVDANTTRKDFIANSVIKRNPKIVG
IYRLVMKTGSDNFRASAIQGVMKRIKAKGIDVVVYEPALNESEFFRSRVIHSLDEFKQMS
DVILSNRMAPELSDVMEKVYTRDLFGAD