Protein Info for DZA65_RS07125 in Dickeya dianthicola ME23

Annotation: dTDP-4-dehydrorhamnose reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF04321: RmlD_sub_bind" amino acids 1 to 283 (283 residues), 337.7 bits, see alignment E=9.6e-105 TIGR01214: dTDP-4-dehydrorhamnose reductase" amino acids 2 to 283 (282 residues), 341.9 bits, see alignment E=1.3e-106 PF01370: Epimerase" amino acids 3 to 203 (201 residues), 79 bits, see alignment E=7.4e-26 PF16363: GDP_Man_Dehyd" amino acids 34 to 228 (195 residues), 56.8 bits, see alignment E=5.6e-19 PF02719: Polysacc_synt_2" amino acids 35 to 156 (122 residues), 35.2 bits, see alignment E=1.7e-12

Best Hits

Swiss-Prot: 51% identical to RMLD_AGGAC: dTDP-4-dehydrorhamnose reductase (rmlD) from Aggregatibacter actinomycetemcomitans

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 81% identity to ddd:Dda3937_03921)

MetaCyc: 51% identical to dTDP-6-deoxy-L-talose 4-dehydrogenase (NAD+) (Aggregatibacter actinomycetemcomitans)
RXN-13749 [EC: 1.1.1.339]

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133 or 1.1.1.339

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C8V5 at UniProt or InterPro

Protein Sequence (284 amino acids)

>DZA65_RS07125 dTDP-4-dehydrorhamnose reductase (Dickeya dianthicola ME23)
MKVLLTGANGQLGCCFQDRLPEGWDVWTTDSDELDITDREQVLTAIAAYPPDVIVNAAAY
TAVDKAENEPEQAALVNKSGPENLALAAKLVGARLVHVSTDYVFDGKATVPYVETDPTNP
LGVYGQTKLDGERAVMAVLPESIIIRTAWVFSEYGNNFVKTMLRLGKEREMLGIVADQRG
CPTYAGDIAQAIIDLLKLGAAGGIYHFCGNKEVAWNEFSEAIFAKAVDLRKLEKAPVVNA
IATDQYPTPAKRPLYSSLNCKKIKSLGIELSDWQSALEDVLAKV