Protein Info for DZA65_RS07115 in Dickeya dianthicola ME23

Annotation: glucose-1-phosphate thymidylyltransferase RfbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 34 to 53 (20 residues), see Phobius details TIGR01207: glucose-1-phosphate thymidylyltransferase" amino acids 2 to 286 (285 residues), 517 bits, see alignment E=5.5e-160 PF00483: NTP_transferase" amino acids 2 to 238 (237 residues), 256 bits, see alignment E=3.8e-80 PF12804: NTP_transf_3" amino acids 3 to 132 (130 residues), 36.6 bits, see alignment E=5.2e-13

Best Hits

Swiss-Prot: 78% identical to RMLA2_ECOLI: Glucose-1-phosphate thymidylyltransferase 2 (rffH) from Escherichia coli (strain K12)

KEGG orthology group: K00973, glucose-1-phosphate thymidylyltransferase [EC: 2.7.7.24] (inferred from 95% identity to ddc:Dd586_1244)

MetaCyc: 78% identical to glucose-1-phosphate thymidylyltransferase 2 (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate thymidylyltransferase. [EC: 2.7.7.24]

Predicted SEED Role

"Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 2.7.7.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D6U7 at UniProt or InterPro

Protein Sequence (289 amino acids)

>DZA65_RS07115 glucose-1-phosphate thymidylyltransferase RfbA (Dickeya dianthicola ME23)
MKGIVLAGGSGTRLYPITRGVSKQLLPIYDKPMIYYPISVLMLAGIRDILIISTPDDLPA
YRRLLGNGSRFGINLCYAEQPSPDGLAQAFLIGETFISGEPCALVLGDNIFFGQSFGKKL
EKVAARTEGATVFGYQVMDPERFGVVEFDDNNQAVSLEEKPSKPKSNWAVTGLYFYDRHV
VEMARQVKPSARGELEITTLNEMYLQQGNLNVEVLGRGFAWLDTGTHDSLLEASQFISTI
EKRQGFKVACLEEIAFRKGWLTREQVADEARNLSKTHYGQYLAQLLIGM