Protein Info for DZA65_RS07085 in Dickeya dianthicola ME23

Annotation: polysaccharide export protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF02563: Poly_export" amino acids 82 to 165 (84 residues), 82.6 bits, see alignment E=3.7e-27 PF22461: SLBB_2" amino acids 171 to 249 (79 residues), 87 bits, see alignment E=1.4e-28 amino acids 256 to 342 (87 residues), 82.8 bits, see alignment E=3.1e-27 PF10531: SLBB" amino acids 173 to 221 (49 residues), 29 bits, see alignment 1.5e-10 amino acids 256 to 310 (55 residues), 20.9 bits, see alignment 5.1e-08 PF18412: Wza_C" amino acids 345 to 374 (30 residues), 59.3 bits, see alignment (E = 4.8e-20)

Best Hits

Swiss-Prot: 70% identical to AMSH_ERWAM: Amylovoran export outer membrane protein AmsH (amsH) from Erwinia amylovora

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 97% identity to ddd:Dda3937_03929)

MetaCyc: 66% identical to outer membrane polysaccharide export protein Wza (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Polysaccharide export lipoprotein Wza" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C4A9 at UniProt or InterPro

Protein Sequence (378 amino acids)

>DZA65_RS07085 polysaccharide export protein (Dickeya dianthicola ME23)
MLKPTLKVIPLMLSATFLAGCTLVPGTHLSTSGKEVVEQPDDDFNINKLVNVYPITPLLM
EKMRLRPAVAQNNPSLDAELKRYEYHIGIGDVLMVTVWDHPELTTPAGTYRTAADTGNWV
HSDGTIFYPYIGKLRVVDKTLTEVRDEIMRRLAQYIESPQVEVSIAAFRSQKAYVTGEVV
RSGQQPISNVPLTVLDAINNAGGLSEFADWRNLVLTHNGKDERISLQALMQNGDLSQNRL
LYPGDILFVPRNDGLKVFVMGEVNKQSTLKMDRSGMTLTEALGNAEGMNQMVADATGVFV
IRPLRGTQGPKLANIYQLNTKDATALVMGSEFPLQPYDVVYVTSAPIARWNRLISQLVPT
ISGFNDLSEGSLRIRNWP