Protein Info for DZA65_RS07030 in Dickeya dianthicola ME23

Annotation: 6-phosphogluconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF10282: Lactonase" amino acids 6 to 326 (321 residues), 312.2 bits, see alignment E=5e-97

Best Hits

Swiss-Prot: 76% identical to 6PGL_PECCP: 6-phosphogluconolactonase (pgl) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K07404, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 97% identity to dze:Dd1591_2878)

MetaCyc: 61% identical to 6-phosphogluconolactonase (Escherichia coli K-12 substr. MG1655)
6-phosphogluconolactonase. [EC: 3.1.1.31]

Predicted SEED Role

"6-phosphogluconolactonase (EC 3.1.1.31)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 3.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.31

Use Curated BLAST to search for 3.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D1I7 at UniProt or InterPro

Protein Sequence (331 amino acids)

>DZA65_RS07030 6-phosphogluconolactonase (Dickeya dianthicola ME23)
MQQVVYIASPESQQIHVWQLASSGELSLLQVVDVPGQVQPMVIAPDKRHLYVGVRPEFRV
ISYRIDGQGKLSEVGVAPLPGSPTHLSTDQRGRFLFSASYSDACVSVSPIGDDGVVQAPI
QQLDGLEGCHSTNIDPANRVLWAPCLKEDRIRLYDVADDGRLTESQPAEQRAAAGAGPRH
MAYHPNNRFTYCINELNSSVDVFELDAQGEGKRIQTLNAMPADFTGTCWAADIHITPDGR
HLYTTDRTASLISIFQVSAQDGTLTLTGHQPTQTQPRGFNIDHNGQFLIAAGQKSHHIEV
YRIQPDNGSLTPLARYAVGQGPMWVSVLALD