Protein Info for DZA65_RS06995 in Dickeya dianthicola ME23

Annotation: molybdate ABC transporter ATP-binding protein ModF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 PF00005: ABC_tran" amino acids 24 to 163 (140 residues), 70.4 bits, see alignment E=5.1e-23 amino acids 276 to 429 (154 residues), 91.8 bits, see alignment E=1.2e-29 PF13304: AAA_21" amino acids 396 to 461 (66 residues), 31.9 bits, see alignment E=2.8e-11

Best Hits

Swiss-Prot: 74% identical to MODF_ECOLI: ABC transporter ATP-binding protein ModF (modF) from Escherichia coli (strain K12)

KEGG orthology group: K05776, molybdate transport system ATP-binding protein (inferred from 96% identity to ddd:Dda3937_03999)

Predicted SEED Role

"Putative molybdenum transport ATP-binding protein modF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XYL8 at UniProt or InterPro

Protein Sequence (489 amino acids)

>DZA65_RS06995 molybdate ABC transporter ATP-binding protein ModF (Dickeya dianthicola ME23)
MSLLHIHQAQFRLSDTRMMRLDELTLCQDQCWAFVGANGSGKSALARALCGELLLLSGQR
QCDFQRVARLSFEQLQQLVSLEWQRNNTDMLSADEDDTGRTTAEVIQDSVRDADRCRQLA
TQFGILPLLERRFKYLSTGETRKTMLCQALMAQPDLLILDEPFDGLDVASRAQLTDLLAS
LAAQGQALVMILNRFEDIPAFVGQIGVLADCTLTRQGAREAILSDALVSQLAHSETLADT
ALPEAEDPSQRPTLPPDQPRIRLLHGVVSYNDRRILDDLSWEVLPGQHWQIVGPNGAGKS
TLLSLVTGDHPQGYSNDLTLFGRRRGSGETIWDIKRHIGYVSSSLHLEYRVSASLRNVIL
SGFFDSIGIYQAVSDRQRFLAAQWLELLGLPDSVADAPFQSLSWGQQRLALIVRALVKHP
ALLILDEPLQGLDPLNRQLIRRWLDILIGQGQTQLLFVSHHAQDAPNCITHRLTFVPDGD
GYRYLTESR