Protein Info for DZA65_RS06840 in Dickeya dianthicola ME23

Annotation: succinate dehydrogenase iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF13085: Fer2_3" amino acids 5 to 111 (107 residues), 106.4 bits, see alignment E=1.6e-34 TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein" amino acids 7 to 230 (224 residues), 298.9 bits, see alignment E=1e-93 PF13183: Fer4_8" amino acids 146 to 220 (75 residues), 40.1 bits, see alignment E=9.1e-14 PF13534: Fer4_17" amino acids 148 to 221 (74 residues), 41.6 bits, see alignment E=2.9e-14 PF13237: Fer4_10" amino acids 148 to 217 (70 residues), 35.3 bits, see alignment E=1.7e-12

Best Hits

Swiss-Prot: 89% identical to SDHB_ECOLI: Succinate dehydrogenase iron-sulfur subunit (sdhB) from Escherichia coli (strain K12)

KEGG orthology group: K00240, succinate dehydrogenase iron-sulfur protein [EC: 1.3.99.1] (inferred from 98% identity to ddd:Dda3937_01536)

MetaCyc: 89% identical to succinate:quinone oxidoreductase, iron-sulfur cluster binding protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D283 at UniProt or InterPro

Protein Sequence (238 amino acids)

>DZA65_RS06840 succinate dehydrogenase iron-sulfur subunit (Dickeya dianthicola ME23)
MKVEFSIYRYNPDVDSAPRMQSYTLEAEEGRDMMLLDALILLKEQDPTLAFRRSCREGVC
GSDGLNMNGKNGLACITPVSTLSNGNSKIVIRPLPGLPVVRDLVVDMGQFYAQYEKIKPY
LLNNGKNPPAREHLQSPEQREKLDGLYECIMCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETKARLDDLDDAFSVFRCHGIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA