Protein Info for DZA65_RS06825 in Dickeya dianthicola ME23

Annotation: succinate dehydrogenase cytochrome b556 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01127: Sdh_cyt
  • amino acids 6 to 123 (118 residues), 101.8 bits, E=1.5e-33
• TIGR02970: succinate dehydrogenase, cytochrome b556 subunit
  • amino acids 7 to 126 (120 residues), 126.5 bits, E=3.3e-41

Best Hits

Swiss-Prot: 80% identical to DHSC_SALTY: Succinate dehydrogenase cytochrome b556 subunit (sdhC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 93% identity to dze:Dd1591_2918)

MetaCyc: 80% identical to succinate:quinone oxidoreductase, membrane protein SdhC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

See A0A385XV39 at UniProt or InterPro

Protein Sequence (129 amino acids)

>DZA65_RS06825 succinate dehydrogenase cytochrome b556 subunit (Dickeya dianthicola ME23)
MGKPVKKQRPVNLDLQTIQLPVTAIASILHRVSGVITFVAVGILLWLLGLSLSSQEGFVQ
AAAIMDSFIVKFIVWGILTALAYHIVGGLRHLLMDFGYIEENFAAGSRSAKTSFIITVVL
SFLVGVLVW