Protein Info for DZA65_RS06825 in Dickeya dianthicola ME23

Annotation: succinate dehydrogenase cytochrome b556 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 transmembrane" amino acids 24 to 49 (26 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details PF01127: Sdh_cyt" amino acids 6 to 123 (118 residues), 97.1 bits, see alignment E=4e-32 TIGR02970: succinate dehydrogenase, cytochrome b556 subunit" amino acids 7 to 126 (120 residues), 126.5 bits, see alignment E=3.3e-41

Best Hits

Swiss-Prot: 80% identical to DHSC_SALTY: Succinate dehydrogenase cytochrome b556 subunit (sdhC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 93% identity to dze:Dd1591_2918)

MetaCyc: 80% identical to succinate:quinone oxidoreductase, membrane protein SdhC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XV39 at UniProt or InterPro

Protein Sequence (129 amino acids)

>DZA65_RS06825 succinate dehydrogenase cytochrome b556 subunit (Dickeya dianthicola ME23)
MGKPVKKQRPVNLDLQTIQLPVTAIASILHRVSGVITFVAVGILLWLLGLSLSSQEGFVQ
AAAIMDSFIVKFIVWGILTALAYHIVGGLRHLLMDFGYIEENFAAGSRSAKTSFIITVVL
SFLVGVLVW