Protein Info for DZA65_RS06715 in Dickeya dianthicola ME23
Annotation: ferric iron uptake transcriptional regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 90% identical to FUR_ECOL6: Ferric uptake regulation protein (fur) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: K03711, Fur family transcriptional regulator, ferric uptake regulator (inferred from 99% identity to ddc:Dd586_1162)Predicted SEED Role
"Ferric uptake regulation protein FUR" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Iron acquisition in Vibrio or Oxidative stress or Transport of Iron
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4CHQ6 at UniProt or InterPro
Protein Sequence (148 amino acids)
>DZA65_RS06715 ferric iron uptake transcriptional regulator (Dickeya dianthicola ME23) MTDNNTALKKAGLKVTLPRLKILEVLQDPQCHHVSAEDLYKKLIDMGEEIGLATVYRVLN QFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGRVIEFSDESIEARQREISEKHGI KLTNHSLYLYGHCNSGDCREDDNAHNER