Protein Info for DZA65_RS06705 in Dickeya dianthicola ME23

Annotation: PTS transporter subunit EIIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 71 (26 residues), see Phobius details amino acids 80 to 105 (26 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 283 to 300 (18 residues), see Phobius details amino acids 306 to 329 (24 residues), see Phobius details amino acids 335 to 352 (18 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details TIGR01998: PTS system, N-acetylglucosamine-specific IIBC component" amino acids 4 to 485 (482 residues), 672.8 bits, see alignment E=2.7e-206 PF02378: PTS_EIIC" amino acids 12 to 324 (313 residues), 243.9 bits, see alignment E=2.3e-76 TIGR00826: PTS system, glucose-like IIB component" amino acids 383 to 474 (92 residues), 76.9 bits, see alignment E=1.2e-25 PF00367: PTS_EIIB" amino acids 418 to 449 (32 residues), 50.7 bits, see alignment (E = 9.5e-18)

Best Hits

KEGG orthology group: K02802, PTS system, N-acetylglucosamine-specific IIA component [EC: 2.7.1.69] K02803, PTS system, N-acetylglucosamine-specific IIB component [EC: 2.7.1.69] K02804, PTS system, N-acetylglucosamine-specific IIC component (inferred from 95% identity to ddc:Dd586_1160)

Predicted SEED Role

"PTS system, N-acetylglucosamine-specific IIA component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIB component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIC component (EC 2.7.1.69)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVP3 at UniProt or InterPro

Protein Sequence (490 amino acids)

>DZA65_RS06705 PTS transporter subunit EIIC (Dickeya dianthicola ME23)
MSTLGYLQKVGRALMVPVATLPAAAILMGVGYWIDPIGWGSESALAALLIKSGAAIIEHM
AVLFAVGVAYGMSKDKDGAAALSGFVGYLVLTTLCSPAAVSMIQHIPLAEVPKAFSKIEN
QFIGILVGVISAEIYNRYGQIELPKALSFFNGRRLVPILVSLLMIVVAFVLMYVWPVIYN
ALVSFGEHIQQMGSAGAGIYAFFNRLLIPVGLHHALNSVFWFDVAGINDIPNFLSGQQAI
DAGKAIPGITGRYQAGFFPIMMFGLPGAALAIYHCARPENRSRVAGIMVAAALAAFFTGI
TEPLEFSFMFVAPVLYVLHAVLTGISVFIAASMHWIAGFGFSAGLVDMVLSTRNPLATHW
YMLLLQGAVFFVIYYGVFRFTITRFNLMTPGREAAVTQTVSESAPAPAGNSQSMARGYLQ
AIGGKDNLTGIDACITRLRLSVKDSNLVDESAARNVGAVGVIRLNKQSVQIVVGTQAENI
AAALREVSQE