Protein Info for DZA65_RS06690 in Dickeya dianthicola ME23

Annotation: ROK family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF01047: MarR" amino acids 25 to 63 (39 residues), 28 bits, see alignment 1.6e-10 PF00480: ROK" amino acids 89 to 392 (304 residues), 286.3 bits, see alignment E=3.3e-89

Best Hits

Swiss-Prot: 74% identical to NAGC_ECOL6: N-acetylglucosamine repressor (nagC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02565, N-acetylglucosamine repressor (inferred from 93% identity to dze:Dd1591_2944)

Predicted SEED Role

"N-acetylglucosamine-6P-responsive transcriptional repressor NagC, ROK family" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D8M7 at UniProt or InterPro

Protein Sequence (409 amino acids)

>DZA65_RS06690 ROK family protein (Dickeya dianthicola ME23)
MTTGGQTQIGNIDLVKQLNSAVVYRLIDQQGPISRIQISEQSQLAPASVTKITRQLLERG
LIKEVDQQASTGGRRAISIISETRPFHTVAVRLGRHDATLALYDLQGKQLEEEHRNLPEN
TQDTLESALFRVIDQFIARHQRRIRELIAISVVLPGLVDPGAGVVRYMPHISVDNWPLVD
NLERHFKVYSFVGHDIRSLALAEHYFGATRDCQDSLLVRVHRGVGAGILVNGKIFLGSNG
NVGEIGHIQIDPLGDRCHCGNFGCLETVASNGALEQRARHLLQQEFPSKLTLDDCQIAAI
CKAANRGDLLARELIEAAGQHLGKAISIAVNLFNPQRVVIAGEITVADKILLPAIQRCIN
AQVLKDFRQNLPVVVAELQHLSAIGAFALVKRAMLNGVLLQRLLENQQV