Protein Info for DZA65_RS06600 in Dickeya dianthicola ME23

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00005: ABC_tran" amino acids 17 to 165 (149 residues), 121.7 bits, see alignment E=3.6e-39

Best Hits

Swiss-Prot: 87% identical to GLTL_ECO57: Glutamate/aspartate import ATP-binding protein GltL (gltL) from Escherichia coli O157:H7

KEGG orthology group: K10004, glutamate/aspartate transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 99% identity to ddd:Dda3937_02475)

MetaCyc: 87% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Cystine ABC transporter, ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CXW8 at UniProt or InterPro

Protein Sequence (241 amino acids)

>DZA65_RS06600 amino acid ABC transporter ATP-binding protein (Dickeya dianthicola ME23)
MIFLKNVSKWYGQFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPIQQGQIDV
NGITVNDKRTNLAQLRAKVGMVFQHFELFPHLSIVDNLTLAQVKVLKRNKETAREKGLKL
LARVGLSAHANKFPGQLSGGQQQRVAIARALCMDPVAMLFDEPTSALDPEMINEVLDVMV
ELAQEGMTMMVVTHEMGFARKVAHRVIFMDEGKIIEDTRKEDFFSNPQSDRAKDFLAKIL
H